Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAP3K11 polyclonal antibody (A01)

  • Catalog # : H00004296-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAP3K11.
  • Immunogen:
  • MAP3K11 (NP_002410, 741 a.a. ~ 847 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PPPGTSRSAPGTPGTPRSPPLGLISRPRPSPLRSRIDPWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFQGGPQDCRAQTKDMGAQAPWVPEAGP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004296-A01
    Western Blot detection against Immunogen (37.88 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4296
  • Gene Name:
  • MAP3K11
  • Gene Alias:
  • MGC17114,MLK-3,MLK3,PTK1,SPRK
  • Gene Description:
  • mitogen-activated protein kinase kinase kinase 11
  • Gene Summary:
  • The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42. [provided by RefSeq
  • Other Designations:
  • SH3 domain-containing proline-rich kinase,mixed lineage kinase 3,protein-tyrosine kinase PTK1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook