MIF monoclonal antibody (M01J), clone 2A10-4D3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MIF expression in transfected 293T cell line by MIF monoclonal antibody (M01J), clone 2A10-4D3.
Lane 1: MIF transfected lysate (Predicted MW: 12.5 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung squamous cell carcinoma. [antibody concentration 6 ug/ml]
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1 ~ 10 ug/ml]
Immunoprecipitation
Immunoprecipitation of MIF transfected lysate using anti-MIF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MIF MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MIF is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.39 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant MIF.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
MIF (AAH00447.1, 1 a.a. ~ 115 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (90)
Preparation Method
Cell Culture Production
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.39 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MIF expression in transfected 293T cell line by MIF monoclonal antibody (M01J), clone 2A10-4D3.
Lane 1: MIF transfected lysate (Predicted MW: 12.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung squamous cell carcinoma. [antibody concentration 6 ug/ml]Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MIF on formalin-fixed paraffin-embedded human lung, adenosquamous cell carcinoma tissue. [antibody concentration 1 ~ 10 ug/ml]Immunoprecipitation
Immunoprecipitation of MIF transfected lysate using anti-MIF monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MIF MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MIF is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — MIF
Entrez GeneID
4282GeneBank Accession#
BC000447Protein Accession#
AAH00447.1Gene Name
MIF
Gene Alias
GIF, GLIF, MMIF
Gene Description
macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Gene Ontology
HyperlinkGene Summary
This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq
Other Designations
glycosylation-inhibiting factor|phenylpyruvate tautomerase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com