Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MIF purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004282-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human MIF protein.
  • Immunogen:
  • MIF (NP_002406.1, 1 a.a. ~ 115 a.a) full-length human protein.
  • Sequence:
  • MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • MIF MaxPab rabbit polyclonal antibody. Western Blot analysis of MIF expression in human kidney.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MIF MaxPab rabbit polyclonal antibody. Western Blot analysis of MIF expression in Jurkat.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MIF expression in transfected 293T cell line (H00004282-T01) by MIF MaxPab polyclonal antibody.

    Lane 1: MIF transfected lysate(12.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4282
  • Gene Name:
  • MIF
  • Gene Alias:
  • GIF,GLIF,MMIF
  • Gene Description:
  • macrophage migration inhibitory factor (glycosylation-inhibiting factor)
  • Gene Summary:
  • This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq
  • Other Designations:
  • glycosylation-inhibiting factor,phenylpyruvate tautomerase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook