MICA (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MICA full-length ORF ( NP_000238.1, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
69.3
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MICA
Entrez GeneID
4276GeneBank Accession#
NM_000247.1Protein Accession#
NP_000238.1Gene Name
MICA
Gene Alias
FLJ60820, MGC111087, PERB11.1
Gene Description
MHC class I polypeptide-related sequence A
Omim ID
600169Gene Ontology
HyperlinkGene Summary
MICA encodes the higly polymorphic MHC (HLA) class I chain-related gene A. The protein product is expressed on the cell surface, although unlike canonical class I molecules does not seem to associate with beta-2-microglobulin. It is thought that MICA functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. [provided by RefSeq
Other Designations
HLA class I antigen|MHC class I chain-related gene A protein|MHC class I chain-related protein A|OTTHUMP00000029088|OTTHUMP00000035033|OTTHUMP00000035034|Stress inducible class I homolog
-
Pathway
-
Disease
-
Publication Reference
-
The fatty-acid amide hydrolase inhibitor URB597 inhibits MICA/B shedding.
Kazuma Sekiba, Motoyuki Otsuka, Takahiro Seimiya, Eri Tanaka, Kazuyoshi Funato, Yu Miyakawa, Kazuhiko Koike.
Scientific Reports 2020 Sep; 10(1):15556.
Application:Func, Human, HepG2 cells.
-
The fatty-acid amide hydrolase inhibitor URB597 inhibits MICA/B shedding.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com