Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MGST3 (Human) Recombinant Protein (P01)

  • Catalog # : H00004259-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MGST3 full-length ORF ( AAH00505, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.46
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004259-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4259
  • Gene Name:
  • MGST3
  • Gene Alias:
  • GST-III
  • Gene Description:
  • microsomal glutathione S-transferase 3
  • Gene Summary:
  • The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032567,OTTHUMP00000032600,microsomal GST-3,microsomal GST-III,microsomal glutathione S-transferase III
  • RSS
  • YouTube
  • Linkedin
  • Facebook