MGST3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MGST3 MaxPab rabbit polyclonal antibody. Western Blot analysis of MGST3 expression in human liver.
Western Blot (Cell lysate)
MGST3 MaxPab rabbit polyclonal antibody. Western Blot analysis of MGST3 expression in K-562.
Western Blot (Transfected lysate)
Western Blot analysis of MGST3 expression in transfected 293T cell line (H00004259-T01) by MGST3 MaxPab polyclonal antibody.
Lane 1: MGST3 transfected lysate(16.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MGST3 protein.
Immunogen
MGST3 (NP_004519.1, 1 a.a. ~ 152 a.a) full-length human protein.
Sequence
MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MGST3 MaxPab rabbit polyclonal antibody. Western Blot analysis of MGST3 expression in human liver.Western Blot (Cell lysate)
MGST3 MaxPab rabbit polyclonal antibody. Western Blot analysis of MGST3 expression in K-562.Western Blot (Transfected lysate)
Western Blot analysis of MGST3 expression in transfected 293T cell line (H00004259-T01) by MGST3 MaxPab polyclonal antibody.
Lane 1: MGST3 transfected lysate(16.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MGST3
Entrez GeneID
4259GeneBank Accession#
NM_004528.2Protein Accession#
NP_004519.1Gene Name
MGST3
Gene Alias
GST-III
Gene Description
microsomal glutathione S-transferase 3
Omim ID
604564Gene Ontology
HyperlinkGene Summary
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides. [provided by RefSeq
Other Designations
OTTHUMP00000032567|OTTHUMP00000032600|microsomal GST-3|microsomal GST-III|microsomal glutathione S-transferase III
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com