MGST3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant MGST3.
Immunogen
MGST3 (NP_004519, 28 a.a. ~ 84 a.a) partial recombinant protein with GST tag.
Sequence
NVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPR
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.38 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MGST3
Entrez GeneID
4259GeneBank Accession#
NM_004528Protein Accession#
NP_004519Gene Name
MGST3
Gene Alias
GST-III
Gene Description
microsomal glutathione S-transferase 3
Omim ID
604564Gene Ontology
HyperlinkGene Summary
The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides. [provided by RefSeq
Other Designations
OTTHUMP00000032567|OTTHUMP00000032600|microsomal GST-3|microsomal GST-III|microsomal glutathione S-transferase III
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
MAPEG expression in mouse embryonic stem cell-derived hepatic tissue system.
Yijia L, Danyan Z, Yue D, Meiyuan G, Xin H, Kuifen M, Yu Y.
Stem Cells and Development 2008 Mar; 17(4):775.
Application:WB, Mouse, Mouse embryonic stem cells, embryoid bodies, endothelial cells, liver, heart.
-
Increased Leukotriene C4 Synthesis Accompanied Enhanced Leukotriene C4 Synthase Expression and Activities of Ischemia-Reperfusion-Injured Liver in Rats.
Yang SL, Huang X, Chen HF, Xu D, Chen LJ, Kong Y, Lou YJ.
The Journal of Surgical Research 2007 Mar; 140(1):36.
Application:IHC-P, WB-Ti, Rat, Ischemia–Reperfusion-Injured Liver in Rats.
-
Sodium nitroprusside decreased leukotriene C4 generation by inhibiting leukotriene C4 synthase expression and activity in hepatic ischemia-reperfusion injured rats.
Yang SL, Lou YJ.
Biochemical pharmacology 2006 Nov; 73(5):724.
Application:WB, Rat, Hepatic I/R injury rats.
-
MAPEG expression in mouse embryonic stem cell-derived hepatic tissue system.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com