Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MGST3 polyclonal antibody (A01)

  • Catalog # : H00004259-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MGST3.
  • Immunogen:
  • MGST3 (NP_004519, 28 a.a. ~ 84 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • NVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004259-A01
    Western Blot detection against Immunogen (32.38 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4259
  • Gene Name:
  • MGST3
  • Gene Alias:
  • GST-III
  • Gene Description:
  • microsomal glutathione S-transferase 3
  • Gene Summary:
  • The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, several of which are involved the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032567,OTTHUMP00000032600,microsomal GST-3,microsomal GST-III,microsomal glutathione S-transferase III
  • RSS
  • YouTube
  • Linkedin
  • Facebook