Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MGAT3 monoclonal antibody (M02), clone 1C9

  • Catalog # : H00004248-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant MGAT3.
  • Immunogen:
  • MGAT3 (NP_002400, 430 a.a. ~ 531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • LVSAQNGDFPRWGDYEDKRDLNYIRGLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDRFHYLLDNPYQEPRSTAAGGWRHRGPEGRPPARGKLDEAEV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004248-M02
    Western Blot detection against Immunogen (36.96 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MGAT3 expression in transfected 293T cell line by MGAT3 monoclonal antibody (M02), clone 1C9.

    Lane 1: MGAT3 transfected lysate (Predicted MW: 61.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4248
  • Gene Name:
  • MGAT3
  • Gene Alias:
  • FLJ43371,GNT-III,GNT3,MGC141943,MGC142278
  • Gene Description:
  • mannosyl (beta-1,4-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase
  • Gene Summary:
  • There are believed to be over 100 different glycosyltransferases involved in the synthesis of protein-bound and lipid-bound oligosaccharides. The enzyme encoded by this gene transfers a GlcNAc residue to the beta-linked mannose of the trimannosyl core of N-linked oligosaccharides and produces a bisecting GlcNAc. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • GlcNAc-T III,N-acetylglucosaminyltransferase III,N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase III,OTTHUMP00000028574,OTTHUMP00000042207,beta-1,4-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase
  • RSS
  • YouTube
  • Linkedin
  • Facebook