Product Browser

Last updated: 2017/2/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MFNG (Human) Recombinant Protein (P01)

  • Catalog # : H00004242-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MFNG full-length ORF ( NP_002396.2, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 62.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004242-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4242
  • Gene Name:
  • MFNG
  • Gene Alias:
  • -
  • Gene Description:
  • MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • Gene Summary:
  • This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. [provided by RefSeq
  • Other Designations:
  • O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase,OTTHUMP00000043697,OTTHUMP00000043698,OTTHUMP00000043700,beta-1,3-N-acetylglucosaminyltransferase manic fringe,manic fringe homolog
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook