Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Pathway

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MFNG polyclonal antibody (A01)

  • Catalog # : H00004242-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MFNG.
  • Immunogen:
  • MFNG (NP_002396, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • WASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004242-A01
    Western Blot detection against Immunogen (34.69 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • MFNG polyclonal antibody (A01), Lot # 051207JC01. Western Blot analysis of MFNG expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4242
  • Gene Name:
  • MFNG
  • Gene Alias:
  • -
  • Gene Description:
  • MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • Gene Summary:
  • This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. [provided by RefSeq
  • Other Designations:
  • O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase,OTTHUMP00000043697,OTTHUMP00000043698,OTTHUMP00000043700,beta-1,3-N-acetylglucosaminyltransferase manic fringe,manic fringe homolog
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook