METTL1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
METTL1 MaxPab polyclonal antibody. Western Blot analysis of METTL1 expression in human placenta.
Western Blot (Transfected lysate)
Western Blot analysis of METTL1 expression in transfected 293T cell line (H00004234-T01) by METTL1 MaxPab polyclonal antibody.
Lane 1: METTL1 transfected lysate(30.36 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human METTL1 protein.
Immunogen
METTL1 (AAH00550, 1 a.a. ~ 276 a.a) full-length human protein.
Sequence
MAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
METTL1 MaxPab polyclonal antibody. Western Blot analysis of METTL1 expression in human placenta.Western Blot (Transfected lysate)
Western Blot analysis of METTL1 expression in transfected 293T cell line (H00004234-T01) by METTL1 MaxPab polyclonal antibody.
Lane 1: METTL1 transfected lysate(30.36 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — METTL1
Entrez GeneID
4234GeneBank Accession#
BC000550Protein Accession#
AAH00550Gene Name
METTL1
Gene Alias
C12orf1, FLJ95748, TRM8, YDL201w
Gene Description
methyltransferase like 1
Omim ID
604466Gene Ontology
HyperlinkGene Summary
This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq
Other Designations
D1075-like gene product|OTTHUMP00000196422|methyltransferase-like 1|methyltransferase-like protein 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com