RAB8A monoclonal antibody (M02), clone 3G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant RAB8A.
Immunogen
RAB8A (AAH02977, 108 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
RAB8A monoclonal antibody (M02), clone 3G1 Western Blot analysis of RAB8A expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RAB8A is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — RAB8A
Entrez GeneID
4218GeneBank Accession#
BC002977Protein Accession#
AAH02977Gene Name
RAB8A
Gene Alias
MEL, RAB8
Gene Description
RAB8A, member RAS oncogene family
Omim ID
165040Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the RAS superfamily which are small GTP/GDP-binding proteins with an average size of 200 amino acids. The RAS-related proteins of the RAB/YPT family may play a role in the transport of proteins from the endoplasmic reticulum to the Golgi and the plasma membrane. This protein shares 97%, 96%, and 51% similarity with the dog RAB8, mouse MEL, and mouse YPT1 proteins, respectively and contains the 4 GTP/GDP-binding sites that are present in all the RAS proteins. The putative effector-binding site of this protein is similar to that of the RAB/YPT proteins. However, this protein contains a C-terminal CAAX motif that is characteristic of many RAS superfamily members but which is not found in YPT1 and the majority of RAB proteins. Although this gene was isolated as a transforming gene from a melanoma cell line, no linkage between MEL and malignant melanoma has been demonstrable. This oncogene is located 800 kb distal to MY09B on chromosome 19p13.1. [provided by RefSeq
Other Designations
mel transforming oncogene|mel transforming oncogene (RAB8 homolog)|mel transforming oncogene (derived from cell line NK14)|mel transforming oncogene (derived from cell line NK14)- RAB8 homolog|ras-associated protein RAB8
-
Interactome
-
Publication Reference
-
Synaptic-like Vesicles Facilitate Pioneer Axon Invasion.
Nichols EL, Smith CJ.
Current Biology : CB 2019 Aug; 29(16):2652.
Application:IF, Mouse, dorsal root ganglia.
-
Basal exon skipping and nonsense-associated altered splicing allows bypassing complete CEP290 loss-of-function in individuals with unusually mild retinal disease.
Barny I, Perrault I, Michel C, Soussan M, Goudin N, Rio M, Thomas S, Attié-Bitach T, Hamel C, Dollfus H, Kaplan J, Rozet JM, Gerard X.
Human Molecular Genetics 2018 May; [Epub].
Application:ICC, Human, Fibroblasts.
-
Critical role of Rab11a-mediated recycling endosomes in the assembly of type I parainfluenza viruses.
Stone R, Hayashi T, Bajimaya S, Hodges E, Takimoto T.
Virology 2016 Jan; 487:11.
Application:WB-Ce, Human, HeLa cells.
-
Synaptic-like Vesicles Facilitate Pioneer Axon Invasion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com