MAP3K5 monoclonal antibody (M03), clone 2D11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MAP3K5 monoclonal antibody (M03), clone 2D11 Western Blot analysis of MAP3K5 expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of MAP3K5 expression in transfected 293T cell line by MAP3K5 monoclonal antibody (M03), clone 2D11.
Lane 1: MAP3K5 transfected lysate(155 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAP3K5 is approximately 0.3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAP3K5 on A-431 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (41.58 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAP3K5.
Immunogen
MAP3K5 (AAH54503, 1231 a.a. ~ 1374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Host
Mouse
Reactivity
Human
Isotype
IgG1 Lambda
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.58 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAP3K5 monoclonal antibody (M03), clone 2D11 Western Blot analysis of MAP3K5 expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of MAP3K5 expression in transfected 293T cell line by MAP3K5 monoclonal antibody (M03), clone 2D11.
Lane 1: MAP3K5 transfected lysate(155 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAP3K5 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAP3K5 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — MAP3K5
Entrez GeneID
4217GeneBank Accession#
BC054503Protein Accession#
AAH54503Gene Name
MAP3K5
Gene Alias
ASK1, MAPKKK5, MEKK5
Gene Description
mitogen-activated protein kinase kinase kinase 5
Omim ID
602448Gene Ontology
HyperlinkGene Summary
Mitogen-activated protein kinase (MAPK) signaling cascades include MAPK or extracellular signal-regulated kinase (ERK), MAPK kinase (MKK or MEK), and MAPK kinase kinase (MAPKKK or MEKK). MAPKK kinase/MEKK phosphorylates and activates its downstream protein kinase, MAPK kinase/MEK, which in turn activates MAPK. The kinases of these signaling cascades are highly conserved, and homologs exist in yeast, Drosophila, and mammalian cells. MAPKKK5 contains 1,374 amino acids with all 11 kinase subdomains. Northern blot analysis shows that MAPKKK5 transcript is abundantly expressed in human heart and pancreas. The MAPKKK5 protein phosphorylates and activates MKK4 (aliases SERK1, MAPKK4) in vitro, and activates c-Jun N-terminal kinase (JNK)/stress-activated protein kinase (SAPK) during transient expression in COS and 293 cells; MAPKKK5 does not activate MAPK/ERK. [provided by RefSeq
Other Designations
MAP/ERK kinase kinase 5|MAPK/ERK kinase kinase 5|OTTHUMP00000017275|apoptosis signal regulating kinase
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com