MAP3K4 monoclonal antibody (M06), clone 6A12

Catalog # H00004216-M06

Size

Price

Stock

Quantity

Size:100 ug
Price: USD $ 335.00
Stock:
order now, ship next day
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged MAP3K4 is approximately 0.1ng/ml as a capture antibody.

<em>In situ</em> Proximity Ligation Assay (Cell)
Application

In situ Proximity Ligation Assay (Cell)

Proximity Ligation Analysis of protein-protein interactions between MAP2K3 and MAP3K4. HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and anti-MAP3K4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

QC Test

Western Blot detection against Immunogen (36.63 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant MAP3K4.

    Immunogen

    MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS

    Host

    Mouse

    Reactivity

    Human

    Interspecies Antigen Sequence

    Mouse (88); Rat (95)

    Isotype

    IgG1 Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (36.63 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Recombinant protein)

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged MAP3K4 is approximately 0.1ng/ml as a capture antibody.

    ELISA

    In situ Proximity Ligation Assay (Cell)

    Proximity Ligation Analysis of protein-protein interactions between MAP2K3 and MAP3K4. HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and anti-MAP3K4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Gene Info — MAP3K4

    Entrez GeneID

    4216

    GeneBank Accession#

    NM_005922

    Protein Accession#

    NP_005913

    Gene Name

    MAP3K4

    Gene Alias

    FLJ42439, KIAA0213, MAPKKK4, MEKK4, MTK1, PRO0412

    Gene Description

    mitogen-activated protein kinase kinase kinase 4

    Omim ID

    602425

    Gene Ontology

    Hyperlink

    Gene Summary

    The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Two alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq

    Other Designations

    MAP/ERK kinase kinase 4|MAPK/ERK kinase kinase 4|SSK2/SSK22 MAP kinase kinase kinase, yeast, homolog of|dJ473J16.1 (mitogen-activated protein kinase kinase kinase 4)|predicted protein of HQ0412

  • Interactome
  • Pathway
  • Disease
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All