MEF2B monoclonal antibody (M24), clone 4B5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MEF2B.
Immunogen
MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.44 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MEF2B monoclonal antibody (M24), clone 4B5. Western Blot analysis of MEF2B expression in human stomach.Western Blot (Recombinant protein)
ELISA
-
Gene Info — MEF2B
Entrez GeneID
4207GeneBank Accession#
NM_005919Protein Accession#
NP_005910.1Gene Name
MEF2B
Gene Alias
FLJ32599, FLJ46391, MGC189732, MGC189763, RSRFR2
Gene Description
myocyte enhancer factor 2B
Omim ID
600661Gene Ontology
HyperlinkGene Summary
This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq
Other Designations
MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B)
-
Interactome
-
Disease
-
Publication Reference
-
MEF2B is a member of the BCL6 gene transcriptional complex and induces its expression in diffuse large B-cell lymphoma of the germinal center B-cell-like type.
El Jamal SM, Grada Z, El Dinali MH, Zhou H, Hassan SY, Saad AG, Gibson B, Zhou X, Abulsayen HA, Khadra HS, Friedman J, Shalaby H, Kadi A, Megahed M, Emberesh M, Teruya-Feldstein J, Firpo-Betancourt A, Haikel Y, Fraig M, Hassan M.
Laboratory Investigation; a Journal of Technical Methods and Pathology 2018 Nov; [Epub].
Application:IHC-P, WB, Human, Diffuse large B-cell lymphoma, SU-DHL-4, SU-DHL-5, SU-DHL-6 cells.
-
MEF2B is a member of the BCL6 gene transcriptional complex and induces its expression in diffuse large B-cell lymphoma of the germinal center B-cell-like type.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com