MEF2B MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MEF2B expression in transfected 293T cell line (H00004207-T02) by MEF2B MaxPab polyclonal antibody.
Lane 1: MEF2B transfected lysate(40.15 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MEF2B protein.
Immunogen
MEF2B (NP_005910.1, 1 a.a. ~ 365 a.a) full-length human protein.
Sequence
MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSANRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNPCSTATPGPPLGSFPFLPGGPPVGAEAWARRVPQPAAPPRRPPQSASSLSASLRPPGAPATFLRPSPIPCSSPGPWQSLCGLGPPCAGCPWPTAGPGRRSPGGTSPERSPGTARARGDPTSLQASSEKTQQ
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MEF2B expression in transfected 293T cell line (H00004207-T02) by MEF2B MaxPab polyclonal antibody.
Lane 1: MEF2B transfected lysate(40.15 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MEF2B
Entrez GeneID
4207GeneBank Accession#
NM_005919.1Protein Accession#
NP_005910.1Gene Name
MEF2B
Gene Alias
FLJ32599, FLJ46391, MGC189732, MGC189763, RSRFR2
Gene Description
myocyte enhancer factor 2B
Omim ID
600661Gene Ontology
HyperlinkGene Summary
This gene represents numerous read-through transcripts that span geneID:729991 and 100271849. Many read-through transcripts are predicted to be nonsense-mediated decay (NMD) candidates, and are thought to be non-coding. Some transcripts are predicted to be capable of translation reinitation at a downstream AUG, resulting in expression of at least one isoform of myocyte enhancer factor 2B (MEF2B) from this read-through locus. At least one additional MEF2B variant and isoform can be expressed from a downstream promoter, and is annotated on geneID:100271849. [provided by RefSeq
Other Designations
MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com