MECP2 monoclonal antibody (M01), clone 4B6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
MECP2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of MECP2 expression in rat muscle.
Western Blot (Cell lysate)
MECP2 monoclonal antibody (M01), clone 4B6 Western Blot analysis of MECP2 expression in MCF-7 ( Cat # L046V1 ).
Western Blot (Cell lysate)
MECP2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of MECP2 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of MECP2 expression in transfected 293T cell line by MECP2 monoclonal antibody (M01), clone 4B6.
Lane 1: MECP2 transfected lysate(52.4 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MECP2 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.53 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MECP2.
Immunogen
MECP2 (AAH11612, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MECP2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of MECP2 expression in rat muscle.Western Blot (Cell lysate)
MECP2 monoclonal antibody (M01), clone 4B6 Western Blot analysis of MECP2 expression in MCF-7 ( Cat # L046V1 ).Western Blot (Cell lysate)
MECP2 monoclonal antibody (M01), clone 4B6. Western Blot analysis of MECP2 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Transfected lysate)
Western Blot analysis of MECP2 expression in transfected 293T cell line by MECP2 monoclonal antibody (M01), clone 4B6.
Lane 1: MECP2 transfected lysate(52.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MECP2 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — MECP2
Entrez GeneID
4204GeneBank Accession#
BC011612Protein Accession#
AAH11612Gene Name
MECP2
Gene Alias
AUTSX3, DKFZp686A24160, MRX16, MRX79, MRXS13, MRXSL, PPMX, RTS, RTT
Gene Description
methyl CpG binding protein 2 (Rett syndrome)
Gene Ontology
HyperlinkGene Summary
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of most cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females. [provided by RefSeq
Other Designations
OTTHUMP00000026021|methyl CpG binding protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com