ME1 monoclonal antibody (M03), clone 3H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ME1 monoclonal antibody (M03), clone 3H5. Western Blot analysis of ME1 expression in HepG2 ( Cat # L019V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of ME1 expression in transfected 293T cell line by ME1 monoclonal antibody (M03), clone 3H5.
Lane 1: ME1 transfected lysate(64.1 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ME1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ME1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (88.66 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ME1.
Immunogen
ME1 (AAH25246, 1 a.a. ~ 572 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (88.66 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ME1 monoclonal antibody (M03), clone 3H5. Western Blot analysis of ME1 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of ME1 expression in transfected 293T cell line by ME1 monoclonal antibody (M03), clone 3H5.
Lane 1: ME1 transfected lysate(64.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ME1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 0.5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ME1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — ME1
Entrez GeneID
4199GeneBank Accession#
BC025246Protein Accession#
AAH25246Gene Name
ME1
Gene Alias
HUMNDME, MES
Gene Description
malic enzyme 1, NADP(+)-dependent, cytosolic
Omim ID
154250Gene Ontology
HyperlinkGene Summary
This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. [provided by RefSeq
Other Designations
Malic enzyme, cytoplasmic|NADP-dependent malic enzyme|OTTHUMP00000016792|cytosolic malic enzyme 1|malate dehydrogenase|malic enzyme 1, soluble|pyruvic-malic carboxylase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Metabolic pathways
- PPAR signaling pathway
- Pyruvate metabolism
-
Disease
-
Publication Reference
-
Role for malic enzyme, pyruvate carboxylation and mitochondrial malate import in the glucose-stimulated insulin secretion.
Heart E, Cline GW, Collis LP, Pongratz RL, Gray J, Smith PJ.
American Journal of Physiology. Endocrinology and Metabolism 2009 Jun; 296(6):E1354.
Application：IF, Mouse, Mouse β-cells.
-
Role for malic enzyme, pyruvate carboxylation and mitochondrial malate import in the glucose-stimulated insulin secretion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com