Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MDM4 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004194-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MDM4 partial ORF ( NP_002384, 381 a.a. - 490 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ENSKLFDPCNSVEFLDLAHSSESQETISSMGEQLDNLSEQRTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004194-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4194
  • Gene Name:
  • MDM4
  • Gene Alias:
  • DKFZp781B1423,HDMX,MDMX,MGC132766,MRP1
  • Gene Description:
  • Mdm4 p53 binding protein homolog (mouse)
  • Gene Summary:
  • The human MDM4 gene, which plays a role in apoptosis, encodes a 490-amino acid protein containing a RING finger domain and a putative nuclear localization signal. The MDM4 putative nuclear localization signal, which all Mdm proteins contain, is located in the C-terminal region of the protein. The mRNA is expressed at a high level in thymus and at lower levels in all other tissues tested. MDM4 protein produced by in vitro translation interacts with p53 via a binding domain located in the N-terminal region of the MDM4 protein. MDM4 shows significant structural similarity to p53-binding protein MDM2. Two transcript variants, one protein-coding and the other likely not to be protein-coding, have been found for this gene. [provided by RefSeq
  • Other Designations:
  • MDM4-related protein 1,Mdm4, transformed 3T3 cell double minute 4, p53 binding protein,double minute 4, human homolog of; p53-binding protein,mouse double minute 4 homolog,p53-binding protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook