Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Hot Target

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DNAJB9 monoclonal antibody (M09), clone 3G4

  • Catalog # : H00004189-M09
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DNAJB9.
  • Immunogen:
  • DNAJB9 (NP_036460.1, 114 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • NFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged DNAJB9 is 1 ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4189
  • Gene Name:
  • DNAJB9
  • Gene Alias:
  • DKFZp564F1862,ERdj4,MDG1,MST049,MSTP049
  • Gene Description:
  • DnaJ (Hsp40) homolog, subfamily B, member 9
  • Other Designations:
  • endoplasmic reticulum DnaJ homolog 4,microvascular endothelial differentiation gene 1
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook