Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCSP (Human) Recombinant Protein (P01)

  • Catalog # : H00004184-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MCSP full-length ORF ( AAH14593, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.50
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004184-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4184
  • Gene Name:
  • SMCP
  • Gene Alias:
  • HSMCSGEN1,MCS,MCSP,MGC26305,MGC26519
  • Gene Description:
  • sperm mitochondria-associated cysteine-rich protein
  • Gene Summary:
  • Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000014403,mitochondrial capsule selenoprotein
  • RSS
  • YouTube
  • Linkedin
  • Facebook