Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMCP monoclonal antibody (M04A), clone 4F4

  • Catalog # : H00004184-M04A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant SMCP.
  • Immunogen:
  • SMCP (AAH14593, 1 a.a. ~ 116 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MCDQTKHSKCCPAKGNQCCPPQQNQCCQSKGNQCCPPKQNQCCQPKGSQCCPPKHNHCCQPKPPCCIQARCCGLETKPEVSPLNMESEPNSPQTQDKGCQTQQQPHSPQNESRPSK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004184-M04A
    Western Blot detection against Immunogen (38.5 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4184
  • Gene Name:
  • SMCP
  • Gene Alias:
  • HSMCSGEN1,MCS,MCSP,MGC26305,MGC26519
  • Gene Description:
  • sperm mitochondria-associated cysteine-rich protein
  • Gene Summary:
  • Sperm mitochondria differ in morphology and subcellular localization from those of somatic cells. They are elongated, flattened, and arranged circumferentially to form a helical coiled sheath in the midpiece of the sperm flagellum. The protein encoded by this gene localizes to the capsule associated with the mitochondrial outer membranes and is thought to function in the organization and stabilization of the helical structure of the sperm's mitochondrial sheath. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000014403,mitochondrial capsule selenoprotein
  • RSS
  • YouTube
  • Linkedin
  • Facebook