Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCM6 polyclonal antibody (A01)

  • Catalog # : H00004175-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MCM6.
  • Immunogen:
  • MCM6 (NP_005906, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DLAAAAEPGAGSQHLEVRDEVAEKCQKLFLDFLEEFQSSDGEIKYLQLAEELIRPERNTLVVSFVDLEQFNQQLSTTIQEEFYRVYPYLCRALKTFVKDRKEIPLAKDF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004175-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MCM6 polyclonal antibody (A01), Lot # ABNOVA060622QCS1. Western Blot analysis of MCM6 expression in U-2 OS.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • MCM6 polyclonal antibody (A01), Lot # 050919JC01 Western Blot analysis of MCM6 expression in SJCRH30 ( Cat # L027V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4175
  • Gene Name:
  • MCM6
  • Gene Alias:
  • MCG40308,Mis5,P105MCM
  • Gene Description:
  • minichromosome maintenance complex component 6
  • Gene Summary:
  • The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication. [provided by RefSeq
  • Other Designations:
  • DNA replication licensing factor MCM6,MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe),MIS5 homolog,minichromosome maintenance deficient (mis5, S. pombe) 6,minichromosome maintenance deficient 6 homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook