MCM3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MCM3 partial ORF ( NP_002379, 699 a.a. - 808 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.84
Interspecies Antigen Sequence
Mouse (75); Rat (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MCM3
Entrez GeneID
4172GeneBank Accession#
NM_002388Protein Accession#
NP_002379Gene Name
MCM3
Gene Alias
HCC5, MGC1157, P1-MCM3, P1.h, RLFB
Gene Description
minichromosome maintenance complex component 3
Omim ID
602693Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq
Other Designations
DNA polymerase alpha holoenzyme-associated protein P1|DNA replication factor MCM3|MCM3 minichromosome maintenance deficient 3|OTTHUMP00000016600|cervical cancer proto-oncogene 5|hRlf beta subunit|minichromosome maintenance deficient 3|replication licensin
-
Interactome
-
Pathway
-
Publication Reference
-
The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.
Henderson D, Hall L, Prpic N, Hessling J, Parker M, Sampson S, Simkins S, Brough G, Dixon E, Lenz K, Knapp S, Murphy P, Taylor A, Fischer T, Malinowski DP.
J Immunol Methods 2011 May; 370:1.
Application:WB, Recombinant protein.
-
The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com