Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCM3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004172-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MCM3 partial ORF ( NP_002379, 699 a.a. - 808 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004172-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4172
  • Gene Name:
  • MCM3
  • Gene Alias:
  • HCC5,MGC1157,P1-MCM3,P1.h,RLFB
  • Gene Description:
  • minichromosome maintenance complex component 3
  • Gene Summary:
  • The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq
  • Other Designations:
  • DNA polymerase alpha holoenzyme-associated protein P1,DNA replication factor MCM3,MCM3 minichromosome maintenance deficient 3,OTTHUMP00000016600,cervical cancer proto-oncogene 5,hRlf beta subunit,minichromosome maintenance deficient 3,replication licensin
  • RSS
  • YouTube
  • Linkedin
  • Facebook