MCM3 monoclonal antibody (M04), clone 2H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MCM3.
Immunogen
MCM3 (NP_002379, 699 a.a. ~ 808 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AKDGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (75); Rat (79)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in human ovarian cancer.Western Blot (Cell lysate)
MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
MCM3 monoclonal antibody (M04), clone 2H3. Western Blot analysis of MCM3 expression in Y-79 ( Cat # L042V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MCM3 is approximately 0.1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MCM3 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MCM3
Entrez GeneID
4172GeneBank Accession#
NM_002388Protein Accession#
NP_002379Gene Name
MCM3
Gene Alias
HCC5, MGC1157, P1-MCM3, P1.h, RLFB
Gene Description
minichromosome maintenance complex component 3
Omim ID
602693Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with, and thus is acetlyated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. [provided by RefSeq
Other Designations
DNA polymerase alpha holoenzyme-associated protein P1|DNA replication factor MCM3|MCM3 minichromosome maintenance deficient 3|OTTHUMP00000016600|cervical cancer proto-oncogene 5|hRlf beta subunit|minichromosome maintenance deficient 3|replication licensin
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com