MCM2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MCM2 partial ORF ( AAH07670, 805 a.a. - 904 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MCM2
Entrez GeneID
4171GeneBank Accession#
BC007670Protein Accession#
AAH07670Gene Name
MCM2
Gene Alias
BM28, CCNL1, CDCL1, D3S3194, KIAA0030, MGC10606, MITOTIN, cdc19
Gene Description
minichromosome maintenance complex component 2
Omim ID
116945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. [provided by RefSeq
Other Designations
DNA replication licensing factor MCM2|MCM2 minichromosome maintenance deficient 2, mitotin|cell devision cycle-like 1|cyclin-like 1|minichromosome maintenance deficient 2 (mitotin)|nuclear protein BM28
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.
Henderson D, Hall L, Prpic N, Hessling J, Parker M, Sampson S, Simkins S, Brough G, Dixon E, Lenz K, Knapp S, Murphy P, Taylor A, Fischer T, Malinowski DP.
J Immunol Methods 2011 May; 370:1.
Application：WB, Recombinant protein.
-
The selection and characterization of antibodies to minichromosome maintenance proteins that highlight cervical dysplasia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com