Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCM2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004171-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MCM2 partial ORF ( AAH07670, 805 a.a. - 904 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004171-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4171
  • Gene Name:
  • MCM2
  • Gene Alias:
  • BM28,CCNL1,CDCL1,D3S3194,KIAA0030,MGC10606,MITOTIN,cdc19
  • Gene Description:
  • minichromosome maintenance complex component 2
  • Gene Summary:
  • The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein forms a complex with MCM4, 6, and 7, and has been shown to regulate the helicase activity of the complex. This protein is phosphorylated, and thus regulated by, protein kinases CDC2 and CDC7. [provided by RefSeq
  • Other Designations:
  • DNA replication licensing factor MCM2,MCM2 minichromosome maintenance deficient 2, mitotin,cell devision cycle-like 1,cyclin-like 1,minichromosome maintenance deficient 2 (mitotin),nuclear protein BM28
  • RSS
  • YouTube
  • Linkedin
  • Facebook