Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCL1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00004170-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MCL1 protein.
  • Immunogen:
  • MCL1 (ABM92245.1, 1 a.a. ~ 350 a.a) full-length human protein.
  • Sequence:
  • MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Entrez GeneID:
  • 4170
  • Gene Name:
  • MCL1
  • Gene Alias:
  • BCL2L3,EAT,MCL1L,MCL1S,MGC104264,MGC1839,TM
  • Gene Description:
  • myeloid cell leukemia sequence 1 (BCL2-related)
  • Gene Summary:
  • The protein encoded by this gene belongs to the Bcl-2 family. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032794,OTTHUMP00000032795,induced myeloid leukemia cell differentiation protein Mcl-1,myeloid cell leukemia sequence 1,myeloid cell leukemia sequence 1, isoform 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook