Product Browser

Last updated: 2017/7/16
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCL1 polyclonal antibody (A02)

  • Catalog # : H00004170-A02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MCL1.
  • Immunogen:
  • MCL1 (NP_068779, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004170-A02
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4170
  • Gene Name:
  • MCL1
  • Gene Alias:
  • BCL2L3,EAT,MCL1L,MCL1S,MGC104264,MGC1839,TM
  • Gene Description:
  • myeloid cell leukemia sequence 1 (BCL2-related)
  • Gene Summary:
  • The protein encoded by this gene belongs to the Bcl-2 family. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032794,OTTHUMP00000032795,induced myeloid leukemia cell differentiation protein Mcl-1,myeloid cell leukemia sequence 1,myeloid cell leukemia sequence 1, isoform 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook