Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MC3R polyclonal antibody (A01)

  • Catalog # : H00004159-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MC3R.
  • Immunogen:
  • MC3R (NP_063941, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQ
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004159-A01
    Western Blot detection against Immunogen (34.25 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4159
  • Gene Name:
  • MC3R
  • Gene Alias:
  • BMIQ9,MC3,MC3-R
  • Gene Description:
  • melanocortin 3 receptor
  • Gene Summary:
  • This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans. [provided by RefSeq
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook