MBNL1 (Human) Recombinant Protein (P02)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MBNL1 full-length ORF ( AAH43493, 1 a.a. - 382 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
67.76
Interspecies Antigen Sequence
Mouse (99); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MBNL1
-
Interactome
-
Publication Reference
-
Modulatory role of RNA helicases in MBNL-dependent alternative splicing regulation.
Katarzyna Taylor, Agnieszka Piasecka, Arkadiusz Kajdasz, Aleksandra Brzęk, Micaela Polay Espinoza, Cyril F Bourgeois, Artur Jankowski, Małgorzata Borowiak, Katarzyna D Raczyńska, Łukasz J Sznajder, Krzysztof Sobczak.
Cellular and Molecular Life Sciences : CMLS 2023 Oct; 80(11):335.
Application:EMSA, N/A, Recombinant proteins.
-
Modulatory role of RNA helicases in MBNL-dependent alternative splicing regulation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com