MBNL1 monoclonal antibody (M02), clone 3E7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant MBNL1.
Immunogen
MBNL1 (AAH43493, 1 a.a. ~ 382 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLIRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPGSILCMTPATSVVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (67.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MBNL1 monoclonal antibody (M02), clone 3E7 Western Blot analysis of MBNL1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MBNL1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 0.75 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MBNL1 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MBNL1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MBNL1
-
Interactome
-
Publication Reference
-
MBNL1 overexpression is not sufficient to rescue the phenotypes in a mouse model of RNA toxicity.
Yadava RS, Kim YK, Mandal M, Mahadevan K, Gladman JT, Yu Q, Mahadevan MS.
Human Molecular Genetics 2019 Jul; 28(14):2330.
Application:IF, WB-Ti, Mouse, Skeletal muscle, Gastrocnemius/soleus, Quadriceps femoris, Heart.
-
Pharmacological and physiological activation of AMPK improves the spliceopathy in DM1 mouse muscles.
Ravel-Chapuis A, Al-Rewashdy A, Bélanger G, Jasmin BJ.
Human Molecular Genetics 2018 Oct; 27(19):3361.
Application:IF, WB-Ti, Mouse, Muscle.
-
Development of an AP-FRET Based Analysis for Characterizing RNA-Protein Interactions in Myotonic Dystrophy (DM1).
Rehman S, Gladman JT, Periasamy A, Sun Y, Mahadevan MS.
PLoS One 2014 Apr; 9(4):e95957.
Application:RNA-IP, Mouse, Skeletal muscle, Fibroblasts.
-
MBNL1 overexpression is not sufficient to rescue the phenotypes in a mouse model of RNA toxicity.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com