MBD1 monoclonal antibody (M05J), clone 2B10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MBD1.
This product is belong to Cell Culture Grade Antibody (CX Grade).Immunogen
MBD1 (NP_056671, 415 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HHLGPTLKPTLATRTAQPDHTQAPTKQEAGGGFVLPPPGTDLVFLREGASSPVQVPGPVAASTEALLQEAQCSGLSWVVALPQVKQEKADTQDE
Host
Mouse
Reactivity
Human
Preparation Method
Cell Culture Production
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MBD1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — MBD1
Entrez GeneID
4152GeneBank Accession#
NM_015846Protein Accession#
NP_056671Gene Name
MBD1
Gene Alias
CXXC3, PCM1, RFT
Gene Description
methyl-CpG binding domain protein 1
Omim ID
156535Gene Ontology
HyperlinkGene Summary
DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21. [provided by RefSeq
Other Designations
OTTHUMP00000163504|OTTHUMP00000163506|OTTHUMP00000163507|methyl-CpG binding domain protein 1 isoform PCM1|the regulator of fibroblast growth factor 2 (FGF-2) transcription
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com