Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MATN1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00004146-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MATN1 protein.
  • Immunogen:
  • MATN1 (AAI60064.1, 1 a.a. ~ 496 a.a) full-length human protein.
  • Sequence:
  • MRVLSGTSLMLCSLLLLLQALCSPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIESLDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAEGGRSRSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLIDGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELREIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MATN1 expression in transfected 293T cell line (H00004146-T01) by MATN1 MaxPab polyclonal antibody.

    Lane 1: MATN1 transfected lysate(54.56 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4146
  • Gene Name:
  • MATN1
  • Gene Alias:
  • CMP,CRTM
  • Gene Description:
  • matrilin 1, cartilage matrix protein
  • Gene Summary:
  • This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene have been associated with variety of inherited chondrodysplasias. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000003805,cartilage matrix protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook