MAP4 monoclonal antibody (M03), clone 7C9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAP4 expression in transfected 293T cell line by MAP4 monoclonal antibody (M03), clone 7C9.
Lane 1: MAP4 transfected lysate(10.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAP4 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.8 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant MAP4.
Immunogen
MAP4 (NP_112147.2, 1 a.a. ~ 99 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAP4 expression in transfected 293T cell line by MAP4 monoclonal antibody (M03), clone 7C9.
Lane 1: MAP4 transfected lysate(10.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAP4 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — MAP4
Entrez GeneID
4134GeneBank Accession#
NM_030885.2Protein Accession#
NP_112147.2Gene Name
MAP4
Gene Alias
DKFZp779A1753, MGC8617
Gene Description
microtubule-associated protein 4
Omim ID
157132Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com