MAK monoclonal antibody (M01), clone 3E5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5. Western Blot analysis of MAK expression in Raw 264.7(Cat # L024V1 ).
Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5 Western Blot analysis of MAK expression in HepG2 ( Cat # L019V1 ).
Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5. Western Blot analysis of MAK expression in NIH/3T3(Cat # L018V1 ).
Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5. Western Blot analysis of MAK expression in PC-12(Cat # L012V1 ).
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAK on HepG2 cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAK.
Immunogen
MAK (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5. Western Blot analysis of MAK expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5 Western Blot analysis of MAK expression in HepG2 ( Cat # L019V1 ).Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5. Western Blot analysis of MAK expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
MAK monoclonal antibody (M01), clone 3E5. Western Blot analysis of MAK expression in PC-12(Cat # L012V1 ).Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAK on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — MAK
Entrez GeneID
4117GeneBank Accession#
BC039825Protein Accession#
AAH39825Gene Name
MAK
Gene Alias
dJ417M14.2
Gene Description
male germ cell-associated kinase
Omim ID
154235Gene Ontology
HyperlinkGene Summary
The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized. [provided by RefSeq
Other Designations
OTTHUMP00000016025|serine/threonine protein kinase MAK
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com