Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAGOH (Human) Recombinant Protein (P01)

  • Catalog # : H00004116-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MAGOH full-length ORF ( NP_002361.1, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004116-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4116
  • Gene Name:
  • MAGOH
  • Gene Alias:
  • MAGOHA
  • Gene Description:
  • mago-nashi homolog, proliferation-associated (Drosophila)
  • Gene Summary:
  • Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000010485,mago-nashi homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook