Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAGOH polyclonal antibody (A01)

  • Catalog # : H00004116-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAGOH.
  • Immunogen:
  • MAGOH (NP_002361, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4116
  • Gene Name:
  • MAGOH
  • Gene Alias:
  • MAGOHA
  • Gene Description:
  • mago-nashi homolog, proliferation-associated (Drosophila)
  • Gene Summary:
  • Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000010485,mago-nashi homolog
  • RSS
  • YouTube
  • Linkedin
  • Facebook