MAGEB1 monoclonal antibody (M09), clone 3C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAGEB1 expression in transfected 293T cell line by MAGEB1 monoclonal antibody (M09), clone 3C1.
Lane 1: MAGEB1 transfected lysate (Predicted MW: 39 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEB1 is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAGEB1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAGEB1.
Immunogen
MAGEB1 (NP_803134.1, 86 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QGEENASFSQATTSTESSVKDPVAWEAGMLMHFILRKYKMREPIMKADMLKVVDEKYKDHFTEILNGASRRLELVFGLDLKEDNPSGHTYTLVSKLNLTNDGNLSNDWDF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (51)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAGEB1 expression in transfected 293T cell line by MAGEB1 monoclonal antibody (M09), clone 3C1.
Lane 1: MAGEB1 transfected lysate (Predicted MW: 39 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEB1 is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAGEB1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — MAGEB1
Entrez GeneID
4112GeneBank Accession#
NM_177415Protein Accession#
NP_803134.1Gene Name
MAGEB1
Gene Alias
DAM10, MAGE-Xp, MAGEL1, MGC9322
Gene Description
melanoma antigen family B, 1
Omim ID
300097Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region, and expressed in testis and in a significant fraction of tumors of various histological types. This gene and other MAGEB members are clustered on chromosome Xp22-p21. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene, however, the full length nature of some variants has not been defined. [provided by RefSeq
Other Designations
DSS/AHC critical interval MAGE superfamily 10|OTTHUMP00000023101
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com