MAGEA12 monoclonal antibody (M01), clone 3A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAGEA12.
Immunogen
MAGEA12 (NP_005358, 70 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TLPTTINYTLWSQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQLVFGIEVVE
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MAGEA12 monoclonal antibody (M01), clone 3A10. Western Blot analysis of MAGEA12 expression in human liver.Western Blot (Cell lysate)
MAGEA12 monoclonal antibody (M01), clone 3A10. Western Blot analysis of MAGEA12 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
MAGEA12 monoclonal antibody (M01), clone 3A10. Western Blot analysis of MAGEA12 expression in Jurkat ( Cat # L017V1 ).Western Blot (Cell lysate)
MAGEA12 monoclonal antibody (M01), clone 3A10. Western Blot analysis of MAGEA12 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEA12 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — MAGEA12
Entrez GeneID
4111GeneBank Accession#
NM_005367Protein Accession#
NP_005358Gene Name
MAGEA12
Gene Alias
MAGE12
Gene Description
melanoma antigen family A, 12
Omim ID
300177Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq
Other Designations
OTTHUMP00000024231
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com