MAGEA11 monoclonal antibody (M02A), clone 1C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 monoclonal antibody (M02A), clone 1C11.
Lane 1: MAGEA11 transfected lysate(35.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (60.83 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant MAGEA11.
Immunogen
MAGEA11 (AAH04479.1, 1 a.a. ~ 319 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTLEELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYFPEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMPKSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLTQNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRDPTSYPSLYEDALREEGEGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (41)
Isotype
IgM Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (60.83 KDa) .
Storage Buffer
In ascites fluid
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAGEA11 expression in transfected 293T cell line by MAGEA11 monoclonal antibody (M02A), clone 1C11.
Lane 1: MAGEA11 transfected lysate(35.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — MAGEA11
Entrez GeneID
4110GeneBank Accession#
BC004479.1Protein Accession#
AAH04479.1Gene Name
MAGEA11
Gene Alias
MAGE-11, MAGE11, MAGEA-11, MGC10511
Gene Description
melanoma antigen family A, 11
Omim ID
300344Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
MAGE-11 antigen|OTTHUMP00000024217|melanoma-associated antigen 11
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com