MAGEA10 MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MAGEA10 protein.
Immunogen
MAGEA10 (NP_001011543.1, 1 a.a. ~ 369 a.a) full-length human protein.
Sequence
MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIKNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIIFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (51); Rat (56)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MAGEA10 MaxPab polyclonal antibody. Western Blot analysis of MAGEA10 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of MAGEA10 expression in transfected 293T cell line (H00004109-T04) by MAGEA10 MaxPab polyclonal antibody.
Lane 1: MAGEA10 transfected lysate(40.80 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MAGEA10
Entrez GeneID
4109GeneBank Accession#
NM_001011543Protein Accession#
NP_001011543.1Gene Name
MAGEA10
Gene Alias
MAGE10, MGC10599
Gene Description
melanoma antigen family A, 10
Omim ID
300343Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
MAGE-10 antigen|OTTHUMP00000025894|melanoma-associated antigen 10
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com