MAGEA8 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human MAGEA8 protein.
Immunogen
MAGEA8 (NP_005355.2, 1 a.a. ~ 318 a.a) full-length human protein.
Sequence
MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTLEEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDPAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHFPDIFSKASECMQVIFGIDVKEVDPAGHSYILVTCLGLSYDGLLGDDQSTPKTGLLIIVLGMILMEGSRAPEEAIWEALSVMGLYDGREHSVYWKLRKLLTQEWVQENYLEYRQAPGSDPVRYEFLWGPRALAETSYVKVLEHVVRVNARVRISYPSLHEEALGEEKGV
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
MAGEA8 MaxPab rabbit polyclonal antibody. Western Blot analysis of MAGEA8 expression in human liver.Western Blot (Tissue lysate)
MAGEA8 MaxPab rabbit polyclonal antibody. Western Blot analysis of MAGEA8 expression in mouse spleen.Western Blot (Tissue lysate)
MAGEA8 MaxPab rabbit polyclonal antibody. Western Blot analysis of MAGEA8 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of MAGEA8 expression in transfected 293T cell line (H00004107-T01) by MAGEA8 MaxPab polyclonal antibody.
Lane 1: MAGEA8 transfected lysate(35.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MAGEA8
Entrez GeneID
4107GeneBank Accession#
NM_005364Protein Accession#
NP_005355.2Gene Name
MAGEA8
Gene Alias
MAGE8, MGC2182
Gene Description
melanoma antigen family A, 8
Omim ID
300341Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq
Other Designations
MAGE-8 antigen|OTTHUMP00000024218
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com