MAGEA3 monoclonal antibody (M01), clone 6D10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.
Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.55 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAGEA3.
Immunogen
MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.55 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAGEA3 expression in transfected 293T cell line by MAGEA3 monoclonal antibody (M01), clone 6D10.
Lane 1: MAGEA3 transfected lysate (Predicted MW: 34.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEA3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — MAGEA3
Entrez GeneID
4102GeneBank Accession#
NM_005362Protein Accession#
NP_005353Gene Name
MAGEA3
Gene Alias
HIP8, HYPD, MAGE3, MAGEA6, MGC14613
Gene Description
melanoma antigen family A, 3
Omim ID
300174Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq
Other Designations
MAGE-3 antigen|OTTHUMP00000024220|antigen MZ2-D|melanoma-associated antigen 3
-
Interactome
-
Publication Reference
-
Alpha-type-1 polarized dendritic cell-based vaccination in recurrent high-grade glioma: a phase I clinical trial.
Akiyama Y, Oshita C, Kume A, Iizuka A, Miyata H, Komiyama M, Ashizawa T, Yagoto M, Abe Y, Mitsuya K, Watanabe R, Sugino T, Yamaguchi K, Nakasu Y.
BMC Cancer 2012 Dec; 12:623.
Application：IHC, Human, High-grade glioma tissues.
-
Alpha-type-1 polarized dendritic cell-based vaccination in recurrent high-grade glioma: a phase I clinical trial.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com