Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAGEA3 polyclonal antibody (A01)

  • Catalog # : H00004102-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MAGEA3.
  • Immunogen:
  • MAGEA3 (NP_005353, 44 a.a. ~ 114 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • TLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004102-A01
    Western Blot detection against Immunogen (33.92 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • MAGEA3 polyclonal antibody (A01). Western Blot analysis of MAGEA3 expression in human ovarian cancer.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4102
  • Gene Name:
  • MAGEA3
  • Gene Alias:
  • HIP8,HYPD,MAGE3,MAGEA6,MGC14613
  • Gene Description:
  • melanoma antigen family A, 3
  • Gene Summary:
  • This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq
  • Other Designations:
  • MAGE-3 antigen,OTTHUMP00000024220,antigen MZ2-D,melanoma-associated antigen 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook