MAGEA1 monoclonal antibody (M01), clone 3H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEA1 is approximately 1ng/ml as a capture antibody.
Western Blot detection against Immunogen (33.88 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAGEA1.
Immunogen
MAGEA1 (NP_004979, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.88 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEA1 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — MAGEA1
Entrez GeneID
4100GeneBank Accession#
NM_004988Protein Accession#
NP_004979Gene Name
MAGEA1
Gene Alias
MAGE1, MGC9326
Gene Description
melanoma antigen family A, 1 (directs expression of antigen MZ2-E)
Omim ID
300016Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq
Other Designations
OTTHUMP00000025911|melanoma antigen MAGE-1|melanoma antigen family A 1|melanoma antigen family A, 1|melanoma-associated antigen 1|melanoma-associated antigen MZ2-E
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com