Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMAD9 (Human) Recombinant Protein (P01)

  • Catalog # : H00004093-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SMAD9 full-length ORF ( AAH11559.1, 1 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHCKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 73.04
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004093-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4093
  • Gene Name:
  • SMAD9
  • Gene Alias:
  • MADH6,MADH9,SMAD8A,SMAD8B
  • Gene Description:
  • SMAD family member 9
  • Gene Summary:
  • SMAD family members, such as SMAD9, transduce signals from members of the TGF-beta (see TGFB1; MIM 190180) superfamily, which regulate growth, differentiation, apoptosis, and development (Nishita et al., 1999 [PubMed 10583507]).[supplied by OMIM
  • Other Designations:
  • MAD (mothers against decapentaplegic, Drosophila) homolog 9,MAD, mothers against decapentaplegic homolog 9,Mothers against decapentaplegic, drosophila, homolog of, 9,OTTHUMP00000178565,SMAD, mothers against DPP homolog 9
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook