Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMAD3 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004088-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human SMAD3 protein.
  • Immunogen:
  • SMAD3 (-, 31 a.a. ~ 141 a.a) full-length human protein.
  • Sequence:
  • ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SMAD3 expression in transfected 293T cell line (H00004088-T01) by SMAD3 MaxPab polyclonal antibody.

    Lane 1: SMAD3 transfected lysate(12.32 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4088
  • Protein Accession#:
  • -
  • Gene Name:
  • SMAD3
  • Gene Alias:
  • DKFZp586N0721,DKFZp686J10186,HSPC193,HsT17436,JV15-2,MADH3,MGC60396
  • Gene Description:
  • SMAD family member 3
  • Gene Summary:
  • The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq
  • Other Designations:
  • MAD, mothers against decapentaplegic homolog 3,SMA- and MAD-related protein 3,SMAD, mothers against DPP homolog 3,mad homolog JV15-2,mad protein homolog,mothers against decapentaplegic homolog 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook