Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAD2L1 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00004085-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MAD2L1 protein.
  • Immunogen:
  • MAD2L1 (NP_002349.1, 1 a.a. ~ 205 a.a) full-length human protein.
  • Sequence:
  • MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MAD2L1 expression in transfected 293T cell line (H00004085-T02) by MAD2L1 MaxPab polyclonal antibody.

    Lane 1: MAD2L1 transfected lysate(23.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4085
  • Gene Name:
  • MAD2L1
  • Gene Alias:
  • HSMAD2,MAD2
  • Gene Description:
  • MAD2 mitotic arrest deficient-like 1 (yeast)
  • Gene Summary:
  • MAD2L1 is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. MAD2L1 is related to the MAD2L2 gene located on chromosome 1. A MAD2 pseudogene has been mapped to chromosome 14. [provided by RefSeq
  • Other Designations:
  • MAD2 (mitotic arrest deficient, yeast, homolog)-like 1,MAD2-like 1,MAD2-like protein 1,mitotic arrest deficient, yeast, homolog-like 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook