Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MARCKS (Human) Recombinant Protein (Q01)

  • Catalog # : H00004082-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MARCKS partial ORF ( NP_002347, 2 a.a. - 65 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 32.78
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004082-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4082
  • Gene Name:
  • MARCKS
  • Gene Alias:
  • 80K-L,FLJ14368,FLJ90045,MACS,PKCSL,PRKCSL
  • Gene Description:
  • myristoylated alanine-rich protein kinase C substrate
  • Gene Summary:
  • The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017045,myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L),phosphomyristin
  • RSS
  • YouTube
  • Linkedin
  • Facebook