MARCKS monoclonal antibody (M06), clone 2C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MARCKS monoclonal antibody (M06), clone 2C2. Western Blot analysis of MARCKS expression in Raw 264.7. (The predicted M.W. of MARCKS is 29 to 39 KDa, but it seems the actual M.W. in vivo is between 68 to 90 KDa in different species. http://www.pnas.org/content/88/6/2505.full.pdf , http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=177061)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MARCKS on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MARCKS is approximately 0.03ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to MARCKS on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (32.78 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MARCKS.
Immunogen
MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQANGSAP
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.78 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MARCKS monoclonal antibody (M06), clone 2C2. Western Blot analysis of MARCKS expression in Raw 264.7. (The predicted M.W. of MARCKS is 29 to 39 KDa, but it seems the actual M.W. in vivo is between 68 to 90 KDa in different species. http://www.pnas.org/content/88/6/2505.full.pdf , http://www.ncbi.nlm.nih.gov/entrez/dispomim.cgi?id=177061)Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MARCKS on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MARCKS is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MARCKS on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — MARCKS
Entrez GeneID
4082GeneBank Accession#
NM_002356Protein Accession#
NP_002347Gene Name
MARCKS
Gene Alias
80K-L, FLJ14368, FLJ90045, MACS, PKCSL, PRKCSL
Gene Description
myristoylated alanine-rich protein kinase C substrate
Omim ID
177061Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis. [provided by RefSeq
Other Designations
OTTHUMP00000017045|myristoylated alanine-rich protein kinase C substrate (MARCKS, 80K-L)|phosphomyristin
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com